PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA04G0153500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 281aa    MW: 30814.5 Da    PI: 8.2328
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA04G0153500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-182572148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT +Ed llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
  ORGLA04G0153500.1 25 KGPWTSQEDALLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 72
                       79********************************************97 PP

2Myb_DNA-binding54.23.3e-1778122147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  ORGLA04G0153500.1  78 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 122
                        8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6542072IPR017930Myb domain
SuperFamilySSF466891.39E-2923119IPR009057Homeodomain-like
SMARTSM007171.5E-152474IPR001005SANT/Myb domain
PfamPF002499.9E-172572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-232679IPR009057Homeodomain-like
CDDcd001671.21E-112772No hitNo description
PROSITE profilePS5129425.39673127IPR017930Myb domain
SMARTSM007176.6E-1677125IPR001005SANT/Myb domain
PfamPF002491.0E-1478122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2480125IPR009057Homeodomain-like
CDDcd001676.52E-1182123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MAAAEVQSAA GWGRQLQQDG GGWRKGPWTS QEDALLVEHV RQHGEGRWNS VSKLTGLKRS  60
GKSCRLRWVN YLRPDLKRGK ITPQEESIIV QLHALWGNRW STIARSLPGR TDNEIKNYWR  120
THFKKGKPSK NIERARARFL KQRREMQQSQ QQQQPKLMPT PTPQSKDIIV AETGDARTDD  180
DAGGAAAAVA PSSSSSSLSM AGREAEDLIM HQDAMDDLMM CPAMSYHLLL HGAAVAGHQL  240
SDGGGSCCAS TSEDYGSSED DGATWGSLWN LDGAAGACTL W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-2741259126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096200.0AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634463.10.0PREDICTED: transcription factor WER
TrEMBLI1PMW60.0I1PMW6_ORYGL; Uncharacterized protein
STRINGORGLA04G0153500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-65myb domain protein 79